Research use only. All compounds are for laboratory research. Not for human or veterinary use. 21+.

IGF-1 LR3: What the Research Shows

IGF-1 LR3 (Long R3 IGF-1) is a synthetic 83-amino-acid analog of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 by an arginine substitution at position 3 and a 13-residue N-terminal extension, modifications that increase its stability and reduce its binding to IGF-binding proteins in research models. It is studied in preclinical and cell-culture research as a tool compound for investigating IGF-1-receptor signaling.

IGF-1 LR3 is a fully synthetic analog and does not occur natively in this modified form. As supplied for research, it is a lyophilized powder that is water-soluble on reconstitution.

Verified data

Verified compound data

Property Value
Compound name IGF-1 LR3 (Long R3 IGF-1, LR3-IGF-1)
CAS number 143045-27-6
Molecular formula C400H625N111O115S9
Molecular weight ~9117.60 g/mol
Length 83 residues (Arg3 substitution + 13-residue N-terminal extension)
Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Physical form Lyophilized powder

Data verified against Wikipedia (IGF-1 LR3) and corroborating references: 83 amino acids, MW 9117.60, formula C400H625N111O115S9, CAS 143045-27-6. PubChem does not maintain a single canonical small-molecule CID for the full-length analog; it is identified here by formula, sequence, and CAS.

Mechanism

Research-context mechanism

In preclinical literature, IGF-1 LR3 is studied as an agonist at the IGF-1 receptor. The Arg3 substitution and N-terminal extension are studied for reducing the analog’s affinity for IGF-binding proteins, which in research models is associated with increased free-analog availability relative to native IGF-1. Receptor-binding and downstream cell-signaling pathways are examined in in vitro and animal research models. These mechanisms are described strictly in a research-model context; they are not established human-use mechanisms.

Research summary

Current research summary

IGF-1 LR3 appears across cell-culture and preclinical literature as a stabilized IGF-1 analog research tool. Reported research areas include:

  • IGF-1-receptor binding and agonism studies
  • IGF-binding-protein interaction research models
  • Cell-signaling and proliferation studies in culture
  • Comparative pharmacokinetics vs native IGF-1 (preclinical)

The existing body of work is predominantly in vitro and animal. IGF-1 LR3 is not an FDA-approved drug and has no established human therapeutic use. All framing here is strictly laboratory research.

Questions

Frequently Asked Questions

What is IGF-1 LR3?

IGF-1 LR3 is an 83-amino-acid synthetic analog of insulin-like growth factor 1, studied in preclinical IGF-1-receptor and cell-signaling research models. It is a research compound supplied as a lyophilized powder and is not approved for human use.

What is the molecular formula of IGF-1 LR3?

The molecular formula of IGF-1 LR3 is C400H625N111O115S9, with a molecular weight of approximately 9117.60 g/mol.

What is the CAS number for IGF-1 LR3?

The CAS registry number for IGF-1 LR3 is 143045-27-6.

How does IGF-1 LR3 differ from native IGF-1?

IGF-1 LR3 carries an arginine substitution at position 3 and an additional 13-residue N-terminal extension, giving it 83 residues versus native IGF-1’s 70. In research models these modifications are studied for increased stability and reduced binding-protein affinity.

How is IGF-1 LR3 stored and reconstituted in a research setting?

Lyophilized IGF-1 LR3 is stored at 2 to 8°C, protected from light and humidity. It is reconstituted with a suitable sterile solvent, is water-soluble, and reconstituted material is held at 4°C and used within about 30 days, avoiding repeated freeze-thaw cycles.

Is IGF-1 LR3 approved for human use?

No. IGF-1 LR3 is not an FDA-approved drug and is not intended for human consumption. It is offered strictly as a research compound for laboratory use.

For research use only. Not for human or veterinary use. Not approved by the FDA. 21+

All compounds described in Vantage Aminos research content are sold for laboratory and scientific research purposes only. Not for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any condition. For research use only.
  • HPLC + MS tested, every batch
  • U.S. synthesized
  • Batch COA on the product page