Research use only. All compounds are for laboratory research. Not for human or veterinary use. 21+.

TB-500: What the Research Shows

TB-500 is full-length thymosin beta-4 (Tβ4), a synthetic 43-residue peptide identical in sequence to a naturally occurring protein found broadly across mammalian tissues. It is one of the most studied actin-sequestering peptides in preclinical literature, where it is used as a tool compound to investigate cytoskeletal dynamics, cell migration, and tissue-remodeling signaling in research models.

Thymosin beta-4 is the principal G-actin-sequestering peptide in many cell types, and that actin-binding behavior is the property most examined in the research record. TB-500 is supplied as a lyophilized powder and is water-soluble on reconstitution.

Verified data

Verified compound data

Property Value
Compound name TB-500 (Thymosin beta-4, Tβ4, full-length)
Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Length 43 residues
CAS number 77591-33-4
PubChem CID 45382195
Molecular formula C212H350N56O78S
Molecular weight ~4963 g/mol
Physical form Lyophilized powder

Data verified against PubChem (CID 45382195, Thymosin Beta 4) and corroborating references.

Mechanism

Research-context mechanism

In preclinical literature, thymosin beta-4 is associated with actin sequestration, the binding of G-actin monomers that influences cytoskeletal assembly and dynamics. Research suggests involvement in cell-migration signaling, and studies have examined the peptide in angiogenesis and extracellular-matrix-remodeling research models. These mechanisms are described strictly in in vitro and animal research contexts and are not established human-use mechanisms.

Research summary

Current research summary

Thymosin beta-4 (TB-500) appears across preclinical literature in:

  • Actin-sequestration and cell-migration pathway studies
  • Angiogenesis and VEGF-signaling tissue models
  • Cardiac and vascular tissue research models
  • Extracellular-matrix remodeling studies

The literature is predominantly in vitro and animal. TB-500 is not an FDA-approved drug and has no established human therapeutic use. Because TB-500 is frequently searched in contexts that imply human use, all material here is framed strictly as laboratory research.

Questions

Frequently Asked Questions

What is TB-500?

TB-500 is full-length thymosin beta-4 (Tβ4), a synthetic 43-residue peptide studied in preclinical actin-binding, cell-migration, and tissue-remodeling research models. It is supplied as a research compound, not for human use.

What is the molecular formula of TB-500?

The molecular formula of full-length TB-500 (thymosin beta-4) is C212H350N56O78S, with a molecular weight of approximately 4963 g/mol (PubChem CID 45382195).

What is the CAS number for TB-500?

The CAS registry number for thymosin beta-4 (TB-500) is 77591-33-4.

What is the amino acid sequence of TB-500?

The 43-residue sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES.

Is TB-500 the same as thymosin beta-4?

Yes, Vantage’s TB-500 is full-length thymosin beta-4 (the complete 43-residue peptide). Note that some suppliers sell a short acetylated fragment (Ac-LKKTETQ, the actin-binding region) under the same “TB-500” name; Vantage supplies the full protein, not the fragment.

Is TB-500 approved for human use?

No. TB-500 is not an FDA-approved drug and is not intended for human consumption. It is offered strictly as a research compound for laboratory use.

For research use only. Not for human or veterinary use. Not approved by the FDA. 21+

All compounds described in Vantage Aminos research content are sold for laboratory and scientific research purposes only. Not for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any condition. For research use only.
  • HPLC + MS tested, every batch
  • U.S. synthesized
  • Batch COA on the product page