TB-500 is full-length thymosin beta-4 (Tβ4), a synthetic 43-residue peptide identical in sequence to a naturally occurring protein found broadly across mammalian tissues. It is one of the most studied actin-sequestering peptides in preclinical literature, where it is used as a tool compound to investigate cytoskeletal dynamics, cell migration, and tissue-remodeling signaling in research models.
Thymosin beta-4 is the principal G-actin-sequestering peptide in many cell types, and that actin-binding behavior is the property most examined in the research record. TB-500 is supplied as a lyophilized powder and is water-soluble on reconstitution.
Verified dataVerified compound data
| Property | Value |
|---|---|
| Compound name | TB-500 (Thymosin beta-4, Tβ4, full-length) |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Length | 43 residues |
| CAS number | 77591-33-4 |
| PubChem CID | 45382195 |
| Molecular formula | C212H350N56O78S |
| Molecular weight | ~4963 g/mol |
| Physical form | Lyophilized powder |
Data verified against PubChem (CID 45382195, Thymosin Beta 4) and corroborating references.
MechanismResearch-context mechanism
In preclinical literature, thymosin beta-4 is associated with actin sequestration, the binding of G-actin monomers that influences cytoskeletal assembly and dynamics. Research suggests involvement in cell-migration signaling, and studies have examined the peptide in angiogenesis and extracellular-matrix-remodeling research models. These mechanisms are described strictly in in vitro and animal research contexts and are not established human-use mechanisms.
Research summaryCurrent research summary
Thymosin beta-4 (TB-500) appears across preclinical literature in:
- Actin-sequestration and cell-migration pathway studies
- Angiogenesis and VEGF-signaling tissue models
- Cardiac and vascular tissue research models
- Extracellular-matrix remodeling studies
The literature is predominantly in vitro and animal. TB-500 is not an FDA-approved drug and has no established human therapeutic use. Because TB-500 is frequently searched in contexts that imply human use, all material here is framed strictly as laboratory research.
QuestionsFrequently Asked Questions
What is TB-500?
TB-500 is full-length thymosin beta-4 (Tβ4), a synthetic 43-residue peptide studied in preclinical actin-binding, cell-migration, and tissue-remodeling research models. It is supplied as a research compound, not for human use.
What is the molecular formula of TB-500?
The molecular formula of full-length TB-500 (thymosin beta-4) is C212H350N56O78S, with a molecular weight of approximately 4963 g/mol (PubChem CID 45382195).
What is the CAS number for TB-500?
The CAS registry number for thymosin beta-4 (TB-500) is 77591-33-4.
What is the amino acid sequence of TB-500?
The 43-residue sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES.
Is TB-500 the same as thymosin beta-4?
Yes, Vantage’s TB-500 is full-length thymosin beta-4 (the complete 43-residue peptide). Note that some suppliers sell a short acetylated fragment (Ac-LKKTETQ, the actin-binding region) under the same “TB-500” name; Vantage supplies the full protein, not the fragment.
Is TB-500 approved for human use?
No. TB-500 is not an FDA-approved drug and is not intended for human consumption. It is offered strictly as a research compound for laboratory use.
For research use only. Not for human or veterinary use. Not approved by the FDA. 21+
- HPLC + MS tested, every batch
- U.S. synthesized
- Batch COA on the product page
$51View compound